SPATA20 polyclonal antibody
  • SPATA20 polyclonal antibody

SPATA20 polyclonal antibody

Ref: AB-PAB21876
SPATA20 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SPATA20.
Información adicional
Size 100 uL
Gene Name SPATA20
Gene Alias DKFZp686H1839|FLJ21347|FLJ21969|MGC111032|SSP411|Tisp78
Gene Description spermatogenesis associated 20
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SVSAHNLLRLHGFTGHKDWMDKCVCLLTAFSERMRRVPVALPEMVRALSAQQQTLKQIVICGDRQAKDTKALVQCVHSVYIPNKVLILADGDPSSFLSRQLPFLSTLRRL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SPATA20.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64847
Iso type IgG

Enviar un mensaje


SPATA20 polyclonal antibody

SPATA20 polyclonal antibody