CYB561D1 polyclonal antibody
  • CYB561D1 polyclonal antibody

CYB561D1 polyclonal antibody

Ref: AB-PAB21866
CYB561D1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CYB561D1.
Información adicional
Size 100 uL
Gene Name CYB561D1
Gene Alias FLJ39035|FLJ44753|MGC138204
Gene Description cytochrome b-561 domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MEDRSEGGRARWVMPEIPALWEADAGGSLEVFSPGTLYSWPWRSASAWLKPSYSSHLNTPCSSSAPEKHGSGSTGQGRP
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CYB561D1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 284613
Iso type IgG

Enviar un mensaje


CYB561D1 polyclonal antibody

CYB561D1 polyclonal antibody