ZNF318 polyclonal antibody
  • ZNF318 polyclonal antibody

ZNF318 polyclonal antibody

Ref: AB-PAB21865
ZNF318 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF318.
Información adicional
Size 100 uL
Gene Name ZNF318
Gene Alias FLJ21852|HRIHFB2436|TZF|ZFP318
Gene Description zinc finger protein 318
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IENKGTMVETALKEPQGNLYQWGPLPGIPKDNSPLREKFGSFLCHKDNLDLKAEGPERHTDFLLPHERASQDGSGFSRILSMLADSTSTQEKRRRSFPDIEDEEKFLYGDEEEDLKAESVPKP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF318.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 24149
Iso type IgG

Enviar un mensaje


ZNF318 polyclonal antibody

ZNF318 polyclonal antibody