SRD5A3 polyclonal antibody
  • SRD5A3 polyclonal antibody

SRD5A3 polyclonal antibody

Ref: AB-PAB21862
SRD5A3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SRD5A3.
Información adicional
Size 100 uL
Gene Name SRD5A3
Gene Alias FLJ13352|SRD5A2L
Gene Description steroid 5 alpha-reductase 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KCHVILGNLRKNKAGVVIHCNHRIPFGDWFEYVSSPNYL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SRD5A3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79644
Iso type IgG

Enviar un mensaje


SRD5A3 polyclonal antibody

SRD5A3 polyclonal antibody