PRDM10 polyclonal antibody
  • PRDM10 polyclonal antibody

PRDM10 polyclonal antibody

Ref: AB-PAB21861
PRDM10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PRDM10.
Información adicional
Size 100 uL
Gene Name PRDM10
Gene Alias KIAA1231|MGC131802|PFM7
Gene Description PR domain containing 10
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq SPSHIQGSSSTQGQALQQQQQQQQNSSVQHTYLPSAWNSFRGYSSEIQMMTLPPGQFVITDSGVATPVTTGQVKAVTSGHYVLSESQSELEEKQTSALSGGVQVEPPAHSDSLDPQTNSQQQTTQYIITTTTNGNGS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PRDM10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56980
Iso type IgG

Enviar un mensaje


PRDM10 polyclonal antibody

PRDM10 polyclonal antibody