PARP6 polyclonal antibody
  • PARP6 polyclonal antibody

PARP6 polyclonal antibody

Ref: AB-PAB21860
PARP6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PARP6.
Información adicional
Size 100 uL
Gene Name PARP6
Gene Alias MGC131971
Gene Description poly (ADP-ribose) polymerase family, member 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq QLHGAAYGKGIYLSPISSISFGYSGMGKGQHRMPSKDELVQRYNRMNTIPQTRSIQSRFLQSRNLNCIALCEVITSKDLQKHG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PARP6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56965
Iso type IgG

Enviar un mensaje


PARP6 polyclonal antibody

PARP6 polyclonal antibody