GLT8D2 polyclonal antibody
  • GLT8D2 polyclonal antibody

GLT8D2 polyclonal antibody

Ref: AB-PAB21856
GLT8D2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GLT8D2.
Información adicional
Size 100 uL
Gene Name GLT8D2
Gene Alias FLJ31494
Gene Description glycosyltransferase 8 domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq MGYLDYRKKAIKDLGISPSTCSFNPGVIVANMTEWKHQRITKQLEKWMQKNVEENLYSSSLGGGVATSPMLIVFHGKYSTINPLWHIRHLGWNPDARYSEHFLQEAKLLH
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GLT8D2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 83468
Iso type IgG

Enviar un mensaje


GLT8D2 polyclonal antibody

GLT8D2 polyclonal antibody