FCER1G polyclonal antibody
  • FCER1G polyclonal antibody

FCER1G polyclonal antibody

Ref: AB-PAB21846
FCER1G polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FCER1G.
Información adicional
Size 100 uL
Gene Name FCER1G
Gene Alias FCRG
Gene Description Fc fragment of IgE, high affinity I, receptor for
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq KIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FCER1G.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 2207
Iso type IgG

Enviar un mensaje


FCER1G polyclonal antibody

FCER1G polyclonal antibody