CCPG1 polyclonal antibody
  • CCPG1 polyclonal antibody

CCPG1 polyclonal antibody

Ref: AB-PAB21845
CCPG1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCPG1.
Información adicional
Size 100 uL
Gene Name CCPG1
Gene Alias CPR8|KIAA1254
Gene Description cell cycle progression 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DELNDMKDYLSQCQQEQESFIDYKSLKENLARCWTLTEAEKMSFETQKTNLATENQYLRVSLEKEEKALSSLQEELNKLREQIRILEDKGTSTELVKENQKLKQHLEEEKQKKHSFLSQRETLL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCPG1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 9236
Iso type IgG

Enviar un mensaje


CCPG1 polyclonal antibody

CCPG1 polyclonal antibody