PHF13 polyclonal antibody
  • PHF13 polyclonal antibody

PHF13 polyclonal antibody

Ref: AB-PAB21841
PHF13 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PHF13.
Información adicional
Size 100 uL
Gene Name PHF13
Gene Alias MGC43399|PHF5|SPOC1
Gene Description PHD finger protein 13
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq GKRTIVRQGKQVVFRDEDSTGNDEDIMVDSDDDSWDLVTCFCMKPFAGRPMIECNECHT
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PHF13.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 148479
Iso type IgG

Enviar un mensaje


PHF13 polyclonal antibody

PHF13 polyclonal antibody