PCDH17 polyclonal antibody
  • PCDH17 polyclonal antibody

PCDH17 polyclonal antibody

Ref: AB-PAB21840
PCDH17 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PCDH17.
Información adicional
Size 100 uL
Gene Name PCDH17
Gene Alias PCDH68|PCH68
Gene Description protocadherin 17
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VNDNAPVIVLPTLQNDTAELQVPRNAGLGYLVSTVRALDSDFGESGRLTYEIVDGNDDHLFEIDPSSGEIRTLHPFWEDVTPVVELVVKVTDHGKPTLSAVAKLIIRSVSGSLPEGVPRVNGEQHHWD
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PCDH17.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 27253
Iso type IgG

Enviar un mensaje


PCDH17 polyclonal antibody

PCDH17 polyclonal antibody