IQCK polyclonal antibody
  • IQCK polyclonal antibody

IQCK polyclonal antibody

Ref: AB-PAB21838
IQCK polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IQCK.
Información adicional
Size 100 uL
Gene Name IQCK
Gene Alias FLJ20115|FLJ36575|MGC35048
Gene Description IQ motif containing K
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq ERKRTKFIACDFLTEWLYNQNPKRAGEPFTEFFSIPFVEERLKQHPRPPIPLSLLLTEEEAALYIQSFWRACVVRCDPEIQELRQWQKKLREAKHIHQQVKIFWAKQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IQCK.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 124152
Iso type IgG

Enviar un mensaje


IQCK polyclonal antibody

IQCK polyclonal antibody