C7orf46 polyclonal antibody
  • C7orf46 polyclonal antibody

C7orf46 polyclonal antibody

Ref: AB-PAB21834
C7orf46 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C7orf46.
Información adicional
Size 100 uL
Gene Name C7orf46
Gene Alias DKFZp686F0810|FLJ45875|MGC72075
Gene Description chromosome 7 open reading frame 46
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MERLTLPLGGAAAVDEYLEYRRIVGEDDGGKLFTPEEYEEYKRKVLPLRLQNRLFVSWRSPTGMDCKLVGPET
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C7orf46.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 340277
Iso type IgG

Enviar un mensaje


C7orf46 polyclonal antibody

C7orf46 polyclonal antibody