TRMT61B polyclonal antibody
  • TRMT61B polyclonal antibody

TRMT61B polyclonal antibody

Ref: AB-PAB21833
TRMT61B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TRMT61B.
Información adicional
Size 100 uL
Gene Name TRMT61B
Gene Alias DKFZp564I2178|FLJ20628
Gene Description tRNA methyltransferase 61 homolog B (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq GVCAVYVVNITQVIELLDGIRTCELALSCEKISEVIVRDWLVCLAKQKNGILAQKVESKINTDVQLDSQEKIGVKGELFQEDDHEESHSDFPYGSFPYVARPVHWQPGHTAFLVKLRKV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TRMT61B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55006
Iso type IgG

Enviar un mensaje


TRMT61B polyclonal antibody

TRMT61B polyclonal antibody