C1orf64 polyclonal antibody
  • C1orf64 polyclonal antibody

C1orf64 polyclonal antibody

Ref: AB-PAB21825
C1orf64 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C1orf64.
Información adicional
Size 100 uL
Gene Name C1orf64
Gene Alias MGC24047|RP11-5P18.4
Gene Description chromosome 1 open reading frame 64
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq HLTRVTPMGGGCLAQARATLPLCRGSVASASFPVSPLCPQEVPEAKGKPVKAAPVRSSTWGTVKDSLKALSSCVCGQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C1orf64.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 149563
Iso type IgG

Enviar un mensaje


C1orf64 polyclonal antibody

C1orf64 polyclonal antibody