VEPH1 polyclonal antibody
  • VEPH1 polyclonal antibody

VEPH1 polyclonal antibody

Ref: AB-PAB21819
VEPH1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant VEPH1.
Información adicional
Size 100 uL
Gene Name VEPH1
Gene Alias FLJ12604|KIAA1692|MELT|MGC111426|MGC126709|MGC142115
Gene Description ventricular zone expressed PH domain homolog 1 (zebrafish)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq RAGDLFSLDDSEIEDSLTEALEQIKIISSSSDYQTNNNDQAVVEICITRITTAIRETESIEKHAKALVGLWDSCLEHNLRPFGKDEDTPHAKIASDIMSCILQNYNRPPVMALAIPIAVKFLHRGNKELCRNMS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human VEPH1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79674
Iso type IgG

Enviar un mensaje


VEPH1 polyclonal antibody

VEPH1 polyclonal antibody