LRRC40 polyclonal antibody
  • LRRC40 polyclonal antibody

LRRC40 polyclonal antibody

Ref: AB-PAB21810
LRRC40 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRRC40.
Información adicional
Size 100 uL
Gene Name LRRC40
Gene Alias FLJ20331|RP4-677H15.1|dJ677H15.1
Gene Description leucine rich repeat containing 40
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq GNPLRTIRREIISKGTQEVLKYLRSKIKDDGPSQSESATETAMTLPSESRVNIHAIITLKILDYSDKQATLIPDEVFDAVKSNIVTSINF
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRRC40.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55631
Iso type IgG

Enviar un mensaje


LRRC40 polyclonal antibody

LRRC40 polyclonal antibody