ZNF649 polyclonal antibody
  • ZNF649 polyclonal antibody

ZNF649 polyclonal antibody

Ref: AB-PAB21807
ZNF649 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF649.
Información adicional
Size 100 uL
Gene Name ZNF649
Gene Alias FLJ12644
Gene Description zinc finger protein 649
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq ENYSNLVSVGYQAGKPDALTKLEQGEPLWTLEDEIHSPAHPEIEKADDHLQQPLQNQKILKRTGQRYEHGRTLKSYLGLTNQSRRYNRKEPAEFNGDGAFLHDNHEQMPTEIEFPESRKPISTKSQFL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF649.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 65251
Iso type IgG

Enviar un mensaje


ZNF649 polyclonal antibody

ZNF649 polyclonal antibody