CCBL2 polyclonal antibody
  • CCBL2 polyclonal antibody

CCBL2 polyclonal antibody

Ref: AB-PAB21806
CCBL2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCBL2.
Información adicional
Size 100 uL
Gene Name CCBL2
Gene Alias DKFZp547N1117|DKFZp667D0223|KAT3|MGC9398|RBM1|RBMXL1|RP4-531M19.2
Gene Description cysteine conjugate-beta lyase 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq VTGWKLGWSIGPNHLIKHLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLESVG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCBL2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56267
Iso type IgG

Enviar un mensaje


CCBL2 polyclonal antibody

CCBL2 polyclonal antibody