FNDC8 polyclonal antibody
  • FNDC8 polyclonal antibody

FNDC8 polyclonal antibody

Ref: AB-PAB21802
FNDC8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FNDC8.
Información adicional
Size 100 uL
Gene Name FNDC8
Gene Alias DKFZp434H2215
Gene Description fibronectin type III domain containing 8
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq AVLKKENFNMMNALDQLPKPFPNPKSMNRTVTTKGLPLASKGNLVNFLEDDTINLLKPLPVEDSDCSSDETSISAFSSTLLNPIKL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FNDC8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54752
Iso type IgG

Enviar un mensaje


FNDC8 polyclonal antibody

FNDC8 polyclonal antibody