EBNA1BP2 polyclonal antibody
  • EBNA1BP2 polyclonal antibody

EBNA1BP2 polyclonal antibody

Ref: AB-PAB21801
EBNA1BP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EBNA1BP2.
Información adicional
Size 100 uL
Gene Name EBNA1BP2
Gene Alias EBP2|NOBP|P40
Gene Description EBNA1 binding protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq ESDESLVTDRELQDAFSRGLLKPGLNVVLEGPKKAVNDVNGLKQCLAEFKRDLEWVERLDVTLGPVPEIGGSEAPAPQNKDQKAVDPEDD
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human EBNA1BP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10969
Iso type IgG

Enviar un mensaje


EBNA1BP2 polyclonal antibody

EBNA1BP2 polyclonal antibody