CAMSAP2 polyclonal antibody
  • CAMSAP2 polyclonal antibody

CAMSAP2 polyclonal antibody

Ref: AB-PAB21800
CAMSAP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CAMSAP2.
Información adicional
Size 100 uL
Gene Name CAMSAP2
Gene Alias RP11-93N17.1|CAMSAP1L1
Gene Description calmodulin regulated spectrin-associated protein family, member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TKGALSPITDNTEVDTGIHVPSEDIPETMDEDSSLRDYTVSLDSDMDDASKFLQDYDIRTGNTREALSPCPSTVSTKSQPGSSASSSSGVKM
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CAMSAP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23271
Iso type IgG

Enviar un mensaje


CAMSAP2 polyclonal antibody

CAMSAP2 polyclonal antibody