GSDMC polyclonal antibody
  • GSDMC polyclonal antibody

GSDMC polyclonal antibody

Ref: AB-PAB21797
GSDMC polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GSDMC.
Información adicional
Size 100 uL
Gene Name GSDMC
Gene Alias MLZE
Gene Description gasdermin C
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LPVGRIEEPFWQNFKHLQEEVFQKIKTLAQLSKDVQDVMFYSILAMLRDRGALQDLMNMLELDSSGHLDGPGGAILKKLQQDSNHAWFNPKDP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GSDMC.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56169
Iso type IgG

Enviar un mensaje


GSDMC polyclonal antibody

GSDMC polyclonal antibody