ARFGEF2 polyclonal antibody
  • ARFGEF2 polyclonal antibody

ARFGEF2 polyclonal antibody

Ref: AB-PAB21791
ARFGEF2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ARFGEF2.
Información adicional
Size 100 uL
Gene Name ARFGEF2
Gene Alias BIG2|FLJ23723|dJ1164I10.1
Gene Description ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldin A-inhibited)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq KPIQSKPQSPVIQAAAVSPKFVRLKHSQAQSKPTTPEKTDLTNGEHARSDSGKVSTENGDAPRERGSSLSGTDDGAQEVVKDILEDVVTSAIKAAEKHGLTEPERVLGELECQECAIPPGVDENSQTNGI
Form Liquid
Recomended Dilution The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ARFGEF2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10564
Iso type IgG

Enviar un mensaje


ARFGEF2 polyclonal antibody

ARFGEF2 polyclonal antibody