EDEM3 polyclonal antibody
  • EDEM3 polyclonal antibody

EDEM3 polyclonal antibody

Ref: AB-PAB21781
EDEM3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EDEM3.
Información adicional
Size 100 uL
Gene Name EDEM3
Gene Alias C1orf22
Gene Description ER degradation enhancer, mannosidase alpha-like 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq YLYLLFADKEDIIFDIEDYIFTTEAHLLPLWLSTTNQSISKKNTTSEYTELDDSNFDWTCPNTQILFPNDPLYAQSIREPL
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human EDEM3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80267
Iso type IgG

Enviar un mensaje


EDEM3 polyclonal antibody

EDEM3 polyclonal antibody