LYZL6 polyclonal antibody
  • LYZL6 polyclonal antibody

LYZL6 polyclonal antibody

Ref: AB-PAB21780
LYZL6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LYZL6.
Información adicional
Size 100 uL
Gene Name LYZL6
Gene Alias 1700023H08Rik|LYC1|PRO1485|TKAL754
Gene Description lysozyme-like 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq CNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRP
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LYZL6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57151
Iso type IgG

Enviar un mensaje


LYZL6 polyclonal antibody

LYZL6 polyclonal antibody