NRARP polyclonal antibody
  • NRARP polyclonal antibody

NRARP polyclonal antibody

Ref: AB-PAB21779
NRARP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NRARP.
Información adicional
Size 100 uL
Gene Name NRARP
Gene Alias MGC61598
Gene Description NOTCH-regulated ankyrin repeat protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDGWSALHIAAF
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NRARP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 441478
Iso type IgG

Enviar un mensaje


NRARP polyclonal antibody

NRARP polyclonal antibody