RP5-1000E10.4 polyclonal antibody
  • RP5-1000E10.4 polyclonal antibody

RP5-1000E10.4 polyclonal antibody

Ref: AB-PAB21778
RP5-1000E10.4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RP5-1000E10.4.
Información adicional
Size 100 uL
Gene Name RP5-1000E10.4
Gene Alias DKFZp686A0768|FLJ21168|SIKE
Gene Description suppressor of IKK epsilon
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq AEPVLKAHQSHSAEIESQIDRICEMGEVMRKAVQVDDDQFCKIQEKLAQLELENKELRELLSISSESLQARKENSMD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RP5-1000E10.4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80143
Iso type IgG

Enviar un mensaje


RP5-1000E10.4 polyclonal antibody

RP5-1000E10.4 polyclonal antibody