MTBP polyclonal antibody
  • MTBP polyclonal antibody

MTBP polyclonal antibody

Ref: AB-PAB21772
MTBP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MTBP.
Información adicional
Size 100 uL
Gene Name MTBP
Gene Alias MDM2BP
Gene Description Mdm2, transformed 3T3 cell double minute 2, p53 binding protein (mouse) binding protein, 104kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq DAKELLKYFTSDGLPIGDLQPLPIQKGEKTFVLTPELSPGKLQVLPFEKASVCHYHGIEYCLDDRKALERDGGFSELQSRLIRYETQTTCTR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MTBP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 27085
Iso type IgG

Enviar un mensaje


MTBP polyclonal antibody

MTBP polyclonal antibody