DNAJC24 polyclonal antibody
  • DNAJC24 polyclonal antibody

DNAJC24 polyclonal antibody

Ref: AB-PAB21766
DNAJC24 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DNAJC24.
Información adicional
Size 100 uL
Gene Name DNAJC24
Gene Alias DPH4|JJJ3|ZCSL3
Gene Description DnaJ (Hsp40) homolog, subfamily C, member 24
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq LQRCEDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDTCSLIIELLHY
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DNAJC24.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 120526
Iso type IgG

Enviar un mensaje


DNAJC24 polyclonal antibody

DNAJC24 polyclonal antibody