FLJ43582 polyclonal antibody
  • FLJ43582 polyclonal antibody

FLJ43582 polyclonal antibody

Ref: AB-PAB21760
FLJ43582 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FLJ43582.
Información adicional
Size 100 uL
Gene Name FLJ43582
Gene Alias -
Gene Description FLJ43582 protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VLEPIKLFPVSSLRSPLCLNCGSCRESIRISGELIGNAHSPAPPRTPELETLGWDKQAVLSGAQVILVCA
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FLJ43582.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 389649
Iso type IgG

Enviar un mensaje


FLJ43582 polyclonal antibody

FLJ43582 polyclonal antibody