PEBP4 polyclonal antibody
  • PEBP4 polyclonal antibody

PEBP4 polyclonal antibody

Ref: AB-PAB21759
PEBP4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PEBP4.
Información adicional
Size 100 uL
Gene Name PEBP4
Gene Alias CORK-1|CORK1|GWTM1933|MGC22776|PRO4408
Gene Description phosphatidylethanolamine-binding protein 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq EGKVISLLPKENKTRGSWKMDRFLNRFHLGEPEASTQFMTQNYQDSPTLQAPRERASEPKHK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PEBP4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 157310
Iso type IgG

Enviar un mensaje


PEBP4 polyclonal antibody

PEBP4 polyclonal antibody