TMEM65 polyclonal antibody
  • TMEM65 polyclonal antibody

TMEM65 polyclonal antibody

Ref: AB-PAB21754
TMEM65 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM65.
Información adicional
Size 100 uL
Gene Name TMEM65
Gene Alias -
Gene Description transmembrane protein 65
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq EALNTAQGARDFIYSLHSTERSCLLKELHRFESIAIAQEKLEAPPPT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM65.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 157378
Iso type IgG

Enviar un mensaje


TMEM65 polyclonal antibody

TMEM65 polyclonal antibody