XKR6 polyclonal antibody
  • XKR6 polyclonal antibody

XKR6 polyclonal antibody

Ref: AB-PAB21751
XKR6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant XKR6.
Información adicional
Size 100 uL
Gene Name XKR6
Gene Alias C8orf21|C8orf7|XRG6
Gene Description XK, Kell blood group complex subunit-related family, member 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq YGVLHPTGPRAKILASSCCAELLWGIPLPPDVEPMAPEIPGYRGTQVTPTRAVTEQQEDLTADTCLPVFQVRPMGPPTPLGRPYLPEGPLIKIDMPR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human XKR6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 286046
Iso type IgG

Enviar un mensaje


XKR6 polyclonal antibody

XKR6 polyclonal antibody