TACC1 polyclonal antibody
  • TACC1 polyclonal antibody

TACC1 polyclonal antibody

Ref: AB-PAB21740
TACC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TACC1.
Información adicional
Size 100 uL
Gene Name TACC1
Gene Alias DKFZp686K18126|Ga55|KIAA1103
Gene Description transforming, acidic coiled-coil containing protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PTTTLTSSDFCSPTGNHVNEILESPKKAKSRLITSGCKVKKHETQSLALDACSRDEGAVISQISDISNRDGHATDEEKLASTSCGQKSAGAE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TACC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6867
Iso type IgG

Enviar un mensaje


TACC1 polyclonal antibody

TACC1 polyclonal antibody