CA13 polyclonal antibody
  • CA13 polyclonal antibody

CA13 polyclonal antibody

Ref: AB-PAB21738
CA13 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CA13.
Información adicional
Size 100 uL
Gene Name CA13
Gene Alias CAXIII|FLJ37995|MGC59868
Gene Description carbonic anhydrase XIII
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq EHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CA13.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 377677
Iso type IgG

Enviar un mensaje


CA13 polyclonal antibody

CA13 polyclonal antibody