GINS4 polyclonal antibody
  • GINS4 polyclonal antibody

GINS4 polyclonal antibody

Ref: AB-PAB21736
GINS4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GINS4.
Información adicional
Size 100 uL
Gene Name GINS4
Gene Alias MGC14799|SLD5
Gene Description GINS complex subunit 4 (Sld5 homolog)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq MTEEVDFLGQDSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEHMEE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GINS4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84296
Iso type IgG

Enviar un mensaje


GINS4 polyclonal antibody

GINS4 polyclonal antibody