BZRAP1 polyclonal antibody
  • BZRAP1 polyclonal antibody

BZRAP1 polyclonal antibody

Ref: AB-PAB21735
BZRAP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BZRAP1.
Información adicional
Size 100 uL
Gene Name BZRAP1
Gene Alias DKFZp686F02123|KIAA0612|PRAX-1|PRAX1|RIM-BP1|RIMBP1
Gene Description benzodiazapine receptor (peripheral) associated protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DPGAMEPWALPTWHSWTPGRGGEPSSAAPSIADTPPAALQLQELRSEESSKPKGDGSSRPVGGTDPEGAEACLPSLGQQASSSGPACQRPEDEEVEAFLKAKLNMSFGD
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BZRAP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9256
Iso type IgG

Enviar un mensaje


BZRAP1 polyclonal antibody

BZRAP1 polyclonal antibody