ENY2 polyclonal antibody
  • ENY2 polyclonal antibody

ENY2 polyclonal antibody

Ref: AB-PAB21730
ENY2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ENY2.
Información adicional
Size 100 uL
Gene Name ENY2
Gene Alias DC6|FLJ20480|e(y)2
Gene Description enhancer of yellow 2 homolog (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AINQKLMETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRT
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ENY2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56943
Iso type IgG

Enviar un mensaje


ENY2 polyclonal antibody

ENY2 polyclonal antibody