SMCR8 polyclonal antibody
  • SMCR8 polyclonal antibody

SMCR8 polyclonal antibody

Ref: AB-PAB21729
SMCR8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SMCR8.
Información adicional
Size 100 uL
Gene Name SMCR8
Gene Alias FLJ34716|FLJ60657
Gene Description Smith-Magenis syndrome chromosome region, candidate 8
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq FQASISPPELGETEEGSIENTPSQIDSSCCIGKESDGQLVLPSTPAHTHSDEDGVVSSPPQRHRQKDQGFRVDFSVENANPSSRDNSCEGFPAY
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SMCR8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 140775
Iso type IgG

Enviar un mensaje


SMCR8 polyclonal antibody

SMCR8 polyclonal antibody