RRP15 polyclonal antibody
  • RRP15 polyclonal antibody

RRP15 polyclonal antibody

Ref: AB-PAB21727
RRP15 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RRP15.
Información adicional
Size 100 uL
Gene Name RRP15
Gene Alias CGI-115|KIAA0507|MGC22291
Gene Description ribosomal RNA processing 15 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq VSEEENLKKTPKKKMKMVTGAVASVLEDEATDTSDSEGSCGSEKDHFYSDDDAIEADSEGDAEPCDKENENDGESSVGTN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RRP15.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51018
Iso type IgG

Enviar un mensaje


RRP15 polyclonal antibody

RRP15 polyclonal antibody