TARBP1 polyclonal antibody
  • TARBP1 polyclonal antibody

TARBP1 polyclonal antibody

Ref: AB-PAB21725
TARBP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TARBP1.
Información adicional
Size 100 uL
Gene Name TARBP1
Gene Alias FLJ30482|TRM3|TRP-185|TRP185
Gene Description TAR (HIV-1) RNA binding protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MNELNSVSDLDRCHLYLMVLTELINLHLKVGWKRGNPIWRVISLLKNASIQHLQEMDSGQEPTVGSQIQRVVSMAALAMVCEAIDQKPELQLDSLHAG
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TARBP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6894
Iso type IgG

Enviar un mensaje


TARBP1 polyclonal antibody

TARBP1 polyclonal antibody