IARS2 polyclonal antibody
  • IARS2 polyclonal antibody

IARS2 polyclonal antibody

Ref: AB-PAB21718
IARS2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IARS2.
Información adicional
Size 100 uL
Gene Name IARS2
Gene Alias FLJ10326
Gene Description isoleucyl-tRNA synthetase 2, mitochondrial
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq ALNGMVEMMDRRPYWCISRQRVWGVPIPVFHHKTKDEYLINSQTTEHIVKLVEQHGSDIWWTLPPEQLLPKEVLSEVGGPDALEYVPGQD
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IARS2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55699
Iso type IgG

Enviar un mensaje


IARS2 polyclonal antibody

IARS2 polyclonal antibody