FAM213A polyclonal antibody
  • FAM213A polyclonal antibody

FAM213A polyclonal antibody

Ref: AB-PAB21714
FAM213A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM213A.
Información adicional
Size 100 uL
Gene Name FAM213A
Gene Alias PRO2290|C10orf58|PAMM
Gene Description family with sequence similarity 213, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq KFYGPQRRKMMFMGFIRLGVWYNFFRAWNGGFSGNLEGEGFILGGVFVVGSGKQGILLEHREKEFGDKVNLLSVLEAAKMIKPQTLASEK
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM213A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84293
Iso type IgG

Enviar un mensaje


FAM213A polyclonal antibody

FAM213A polyclonal antibody