TEX34 polyclonal antibody
  • TEX34 polyclonal antibody

TEX34 polyclonal antibody

Ref: AB-PAB21709
TEX34 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TEX34.
Información adicional
Size 100 uL
Gene Name TEX34
Gene Alias C17orf46
Gene Description testis expressed 34
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SVHSNMGLPTPQTFRPWSLNSNCRSFTEENHVSACHHSISAQTSKHLFWANKLIQASEHSLQRAINMQLNNGSAGQPIRSPL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TEX34.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 124783
Iso type IgG

Enviar un mensaje


TEX34 polyclonal antibody

TEX34 polyclonal antibody