CEP112 polyclonal antibody
  • CEP112 polyclonal antibody

CEP112 polyclonal antibody

Ref: AB-PAB21702
CEP112 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CEP112.
Información adicional
Size 100 uL
Gene Name CEP112
Gene Alias CCDC46|MACOCO
Gene Description centrosomal protein 112kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RNTLHKEKDHLVNDYEQNMKLLQTKYDADINLLKQEHALSASKASSMIEELEQNVCQLKQQLQESELQRKQQLRDQE
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CEP112.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 201134
Iso type IgG

Enviar un mensaje


CEP112 polyclonal antibody

CEP112 polyclonal antibody