ADSS polyclonal antibody
  • ADSS polyclonal antibody

ADSS polyclonal antibody

Ref: AB-PAB21689
ADSS polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ADSS.
Información adicional
Size 100 uL
Gene Name ADSS
Gene Alias ADEH|MGC20404
Gene Description adenylosuccinate synthase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq KLDGEIIPHIPANQEVLNKVEVQYKTLPGWNTDISNARAFKELPVNAQNYVRFIEDELQIPVKWIGVGKSRESM
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ADSS.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 159
Iso type IgG

Enviar un mensaje


ADSS polyclonal antibody

ADSS polyclonal antibody