OTOR polyclonal antibody
  • OTOR polyclonal antibody

OTOR polyclonal antibody

Ref: AB-PAB21682
OTOR polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OTOR.
Información adicional
Size 100 uL
Gene Name OTOR
Gene Alias FDP|MGC126737|MGC126739|MIAL|MIAL1
Gene Description otoraplin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq RLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OTOR.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56914
Iso type IgG

Enviar un mensaje


OTOR polyclonal antibody

OTOR polyclonal antibody