ZSCAN2 polyclonal antibody
  • ZSCAN2 polyclonal antibody

ZSCAN2 polyclonal antibody

Ref: AB-PAB21681
ZSCAN2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZSCAN2.
Información adicional
Size 100 uL
Gene Name ZSCAN2
Gene Alias FLJ20595|ZFP29|ZNF854
Gene Description zinc finger and SCAN domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq ATHRRTHMVEKPYKCGVCGKSFSQSSSLIAHQGMHTGEKPYECLTCGESFSWSSNLLKHQRIHTGEKPYKCSECGKCFSQRSQLVVHQRTHTGEKPYKCLMCGKSFSRGSILVMHQRAHLGDKPYRCPECGKGFSWNSVLII
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZSCAN2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54993
Iso type IgG

Enviar un mensaje


ZSCAN2 polyclonal antibody

ZSCAN2 polyclonal antibody