FAM129B polyclonal antibody Ver mas grande

FAM129B polyclonal antibody

AB-PAB21679

Producto nuevo

FAM129B polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name FAM129B
Gene Alias C9orf88|DKFZP434H0820|FLJ13518|FLJ22151|FLJ22298|MEG-3|OC58|bA356B19.6
Gene Description family with sequence similarity 129, member B
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq FLQFYEDQYGVALFNSMRHEIEGTGLPQAQLLWRKVPLDERIVFSGNLFQHQEDSKKWRNRFSLVPHNYGLVLYENKAAYERQVPPRAVINSAGYKILTSV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)<br>Western Blot (1:250-1:500)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM129B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64855
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant FAM129B.

Consulta sobre un producto

FAM129B polyclonal antibody

FAM129B polyclonal antibody